PTM Viewer PTM Viewer

AT5G18650.1

Arabidopsis thaliana [ath]

CHY-type/CTCHY-type/RING-type Zinc finger protein

No PTMs currently found

PLAZA: AT5G18650
Gene Family: HOM05D000548
Other Names: MIEL1,MYB30-Interacting E3 Ligase 1

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 267

MEASPNDRLHFGKMGFGCKHYKRRCQIRAPCCNEVFDCRHCHNESTSTLRNIYDRHDLVRQDVKQVICSVCDTEQPAAQVCSNCGVNMGEYFCSICIFYDDDTEKQQFHCDDCGICRVGGRENFFHCKKCGSCYAVGLRNNHRCVENSMRHHCPICYEYLFDSLKDTNVMKCGHTMHVECYNEMIKRDKFCCPICSRSVIDMSKTWQRLDEEIEATAMPSDYRDKKVWILCNDCNDTTEVHFHIIGQKCGHCRSYNTRAIAPPVLPQ

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR001841 152 196
IPR008913 11 91
IPR017921 88 152
Sites
Show Type Position
Active Site 18
Active Site 20
Active Site 38
Active Site 41
Active Site 31
Active Site 32
Active Site 42
Active Site 56
Active Site 68
Active Site 71
Active Site 81
Active Site 84
Active Site 93
Active Site 96
Active Site 109
Active Site 116
Active Site 110
Active Site 113
Active Site 126
Active Site 133
Active Site 127
Active Site 130
Active Site 142
Active Site 144

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here